Κοινότητα Μητάτου
|
Read other articles:
Lambang Negara Republik Afrika SelatanDetailPemangkuAfrika SelatanDigunakan sejak27 April 2000Mottoǃke e: ǀxarra ǁke Orang yang beraneka ragam bersatu in |Xam Lambang negara Afrika Selatan diperkenalkan pertama kali pada hari kemerdekaan Afrika Selatan 27 April 2000. Lambang ini menggantikan lambang lama yang digunakan sejak tahun 1910.[1] Semboyan ǃke e: ǀxarra ǁke tertulis dalam bahasa Khoisan suku ǀXam yang berarti orang yang beraneka ragam bersatu. logo lama berbahasa ...
One Piece. Большой кушангл. One Piece Жанры приключения, фэнтези, комедийная драма Создатели Мэтт Оуэнс и Стивен Маэда (англ.) (рус. Основано на «One Piece. Большой куш» Режиссёр Марк Йобст[d] В ролях Иньяки Годой Маккэнъю Арата Эмили Радд Джейкоб Ромеро Гибсон Таз Скайлар Комп
Північна Тихоокеанська військова флотиліяНа службі 1939–1945Країна СРСРВид ВМФ СРСРТип військово-морські силиРоль океанська флотиліяЧисельність флотиліяВійни/битви Радянсько-японська війнаПівденно-Сахалінська операціяКурильська десантна операціяКомандуванняВизначн
18th-century painter François Decker Portrait of Pieter Teyler van der Hulst, painted posthumously in 1787 by Wybrand Hendriks after a portrait by Decker, now lost Frans Decker (1684 – 1751) was an 18th-century painter from the Northern Netherlands. Biography Decker was born in 1684. He was a painter whose pictures possess great merit, and are to be met with in almost every collection.[1] He is stated to have been born at Haarlem in 1684, and to have died at the same place in 1751,...
هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (مايو 2020) هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إ...
КортенуоваCortenuova Комуна Країна ІталіяРегіон ЛомбардіяПровінція БерґамоКод ISTAT 016083Поштові індекси 24050Телефонний код 0363Координати 45°32′00″ пн. ш. 9°47′00″ сх. д. / 45.53333° пн. ш. 9.78333° сх. д. / 45.53333; 9.78333Координати: 45°32′00″ пн. ш. 9°47′00″ с
ببتيد عصبي Y الببتيدات العصبية هي نواقل كيميائية مؤلفة من سلاسل صغيرة من الأحماض الأمينية التي تصنعها العصبونات وتحررها. ترتبط الببتيدات العصبية بشكل نموذجي مع المستقبلات المقترنة بالبروتين ج (جي بّي سي آر إس) من أجل تعديل النشاط العصبي والنسج الأخرى مثل الأمعاء، والعضلات...
علم النباتات القديمةصنف فرعي من علم أحياء الحفريات — علم النبات يمتهنه paleobotanist (en) تعديل - تعديل مصدري - تعديل ويكي بيانات أحفورية لورقة نبات وجدت في فرنسا، عمرها حوالي 3 مليون سنة. جزء من سلسلةعلم الأحياء القديمة أحافيرمستحاثة · أثر حفري · مؤشر أحفوري · List of fossil sites...
Alleged Nazi atrocity During the 20th century, there were various alleged instances of soap being made from human body fat. During World War I the British press claimed that the Germans operated a corpse factory in which they made glycerine and soap from the bodies of their own soldiers. Both during and after World War II, widely circulated rumors claimed that soap was being mass-produced from the bodies of the victims of Nazi concentration camps which were located in German-occupied Poland. ...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (ديسمبر 2018) 162° خط طول 162 شرق خريطة لجميع الإحداثيات من جوجل خريطة لجميع الإحداثيات من بينغ تصدير جميع الإحداثيات من ك...
Опис файлу Опис Меморіальна дошка М. Д. Роменскому в Києві (вул. Пушкінська, 22) Джерело Власна робота Час створення 2011-12-19 Автор зображення AMY (talk) 00:25, 8 January 2012 (UTC) Ліцензія див. нижче Ліцензування Я, власник авторських прав на цей твір, публікую його на умовах такої ліцензії: Ц...
The American Religion: The Emergence of the Post-Christian Nation Cover of the first editionAuthorHarold BloomCountryUnited StatesLanguageEnglishSubjectReligion in the United StatesPublisherSimon & SchusterPublication date1992 (1st edition)2006 (2nd edition)Media typePrint (Hardcover and Paperback)Pages288 (1st edition)305 (2nd edition)ISBN0-671-67997-X The American Religion: The Emergence of the Post-Christian Nation (1992; second edition 2006) is a book by literary critic Harold Bl...
Yoruba ArchitectureTop: Osun-Osogbo Sacred Grove a World Heritage Site in Osogbo, Nigeria; Middle: Post-Colonial Yoruba-inspired architecture, Natural History Museum, Obafemi Awolowo University, Ife, Nigeria; Bottom: Interior of the old palace of the Deji of Akure with a low incline stair leading to an elevated platform.Years activec. ? AD - Present Architecture of the Yoruba people Yoruba architecture describes the architectural styles of the Yoruba people of West Africa, dating back to...
1995 American filmIce Cream ManFilm posterDirected byNorman ApsteinWritten bySven DavisonDavid DobkinProduced byPaul NormanStarringClint HowardOlivia HusseyDavid NaughtonJan-Michael VincentDavid WarnerCinematographyGarrett GriffinEdited byAndre VaillancourtMusic byRichard LyonsDistributed byA-Pix Entertainment Inc.Ardustry Home Entertainment LLCRelease date May 9, 1995 (1995-05-09) (United States) Running time86 minutesCountryUnited StatesLanguageEnglishBudget$2 million Ice...
2009 soundtrack album by Various ArtistsThe Princess and the Frog (Original Motion Picture Soundtrack)Soundtrack album by Various ArtistsReleasedNovember 23, 2009Recorded2009GenreJazz, blues, soul, gospel, R&B, zydecoLabelWalt DisneyProducerRandy NewmanWalt Disney Animation Studios chronology Bolt (Original Motion Picture Soundtrack)(2008) ''The Princess and the Frog (Original Motion Picture Soundtrack)''(2009) Tangled (Original Motion Picture Soundtrack)(2010) Randy Newman chrono...
Norwegian politician Marianne BorgenMarianne Borgen in 2019 Photo: Sturlason/Oslo kommune67th Mayor of OsloIn office21 October 2015 – 25 October 2023DeputyKamzy Gunaratnam Abdullah AlsabeehgGoverning MayorRaymond JohansenPreceded byFabian StangSucceeded byAnne Lindboe Personal detailsBorn (1951-06-02) 2 June 1951 (age 72)Oslo, NorwayPolitical partySocialist LeftSpouseLars B. KristofersenChildren3 Marianne Borgen (born 2 June 1951) is a Norwegian politician for the Socialist Le...
Amusement park in northeastern Italy This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Gardaland – news · newspapers · books · scholar · JSTOR (September 2020) (Learn how and when to remove this template message) Gardaland ResortGardaland's entranceLocationCastelnuovo del Garda, ItalyCoordinates45°27′16″N 10°42′50″E / 45.45444°N...
This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article is missing information about Early life, more Career, Personal life, Achievements and honours. Please expand the article to include this information. Further details may exist on the talk page. (October 2021) This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Co...
Spanish politician (1973–2002) María Martín Alonso (21 February 1973 – 24 May 2002) was a Spanish politician of the People's Party of Galicia (PPdeG). Born in Moaña, Province of Pontevedra, Martín graduated in Business Sciences from the University of Santiago de Compostela.[1] She became the councillor in charge of sports in her hometown, as well as deputy mayor to Alberto Currás. She was president of the New Generations branch in her town. She was 11th on the PPdeG list for ...