Symmachus (papež)

Read other articles:

John Y. ColeBorn (1940-07-30) July 30, 1940 (age 83)Ellensburg, Washington, United StatesNationalityAmericanEducationUniversity of WashingtonJohns Hopkins UniversityGeorge Washington UniversityOccupation(s)Historian of the Library of Congress(2016-present) John Y. Cole (born July 30, 1940) is an American librarian, historian, and author. He was the founding director of the Center for the Book at the Library of Congress and in 2016 became the first official historian of the Library of Con...

 

 

Ostra-Allee WappenStraße in Dresden Ostra-Allee Ostra-Allee 1895 Basisdaten Ort Dresden Hist. Namen Julian-Grimau-Allee (DDR-Zeit) Querstraßen Magdeburger Straße, Theaterstraße, Hertha-Lindner-Straße, Am Zwingerteich, Kleine Packhofstraße, Maxstraße, Könneritzstraße und Weißeritzstraße. Plätze Postplatz Bauwerke Haus der Presse Nutzung Nutzergruppen Kraftverkehr, Fußverkehr, Radverkehr Die Ostra-Allee am Zwinger Die Ostra-Allee am Haus der Presse mit Blick zum Postplatz Die Ostra...

 

 

Telecommunications company You can help expand this article with text translated from the corresponding article in German. Click [show] for important translation instructions. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedia. Consider adding a topic to this template: the...

Bandeira de Assú Aplicação ... Proporção 7:10 Adoção 10 de outubro de 1969[1] Tipo municipais A bandeira do Assú é um dos símbolos oficiais do município brasileiro supracitado, localizado no interior do estado do Rio Grande do Norte[2]. Os outros símbolos são o hino e o brasão. Descrição Foi instituída pela Lei Municipal nº 06/69, datada de 10 de outubro de 1969[1]. Seu desenho consiste em um retângulo dividido horizontalmente em três faixas de mesma largura, sendo a super...

 

 

الحمة السورية البحر الميت جزء من سلسلة مقالات حولدولة إسرائيل الجغرافيا أرض إسرائيل مناطق مدن النقل البحر الأبيض المتوسط البحر الأحمر البحر الميت التاريخ تاريخ مملكتي إسرائيل ويهوذا القديمتين تاريخ يهودي خط زمني صهيونية عليا تيودور هرتزل وعد بلفور الانتداب البريطاني عل...

 

 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) كاترين ووكر معلومات شخصية الميلاد سنة 1972 (العمر 50–51 سنة)  دبلن  مواطنة أيرلندا  الحياة العملية المهنة ممثلة[1][2]  المواقع IMDB صفحتها على IMDB...

Угне МажутайтітеUgnė MažutaitytėЗагальна інформаціяГромадянство  ЛитваНародження 14 березня 1997(1997-03-14) (26 років)СпортВид спорту спортивне плавання[1] Участь і здобутки Угне Мажутайтіте (14 березня 1997) — литовська плавчиня. Учасниця Чемпіонату світу з водних видів спор...

 

 

عبد الرحيم زهيو معلومات شخصية الميلاد 26 سبتمبر 1985 (العمر 38 سنة)ڨابس، تونس الطول 1.84 م (6 قدم 1⁄2 بوصة) الإقامة ڨابس، تونس الجنسية تونسية الأصل تونسية الوزن 65 كـغ (143 رطل) الحياة العملية الحدث 800 متر - T12 1500 متر - T12 5000 متر - T12 10000 متر - T12 بداية الاحتراف 2006 سنوات النشاط 2...

 

 

Patung Luigi Pigorini di Museum Nasional Prasejarah dan Etnografi Pigorini di Roma Luigi Pigorini (Fontanellato, 10 Januari 1842 – Padova, 1 April 1925) merupakan seorang ahli prasejarah, arkeolog dan etnografer berkebangsaan Italia. Karya terpilih with Strobel Le terremare e le palafitte del Parmense (subtitle) seconda relazione del prof. P. Strobel e di L. Pigorini Tipi di G. Bernadoni, Milano (1864) - also in parts in Atti della Società italiana di Scienze Naturali (Milan). with Lubbock...

Цей список належить до вибраних списків української Вікіпедії. Коктейль ІБА «Секс на пляжі» Офіційні коктейлі ІБА (англ. IBA official cocktails) — коктейлі, що обрані Міжнародною асоціацією барменів (МАБ, англ. IBA — International Bartenders Association) до списку коктейлів, які дозволяється змішув

 

 

أزواد  علم الاسم الرسمي دولة أزواد المستقلة(بالفرنسية: État indépendant de l’Azawad)‏    الإحداثيات 16°16′00″N 0°03′00″W / 16.266666666667°N 0.05°W / 16.266666666667; -0.05  تاريخ التأسيس 6 أبريل 2012  تقسيم إداري  البلد مالي[1]  العاصمة تمبكتو  تاريخ الإلغاء 2013  خصائص جغرا...

 

 

Ange Hyacinthe Maxence Ange Hyacinthe Maxence de Damas de Cormaillon, baron de Damas (30 September 1785 – 6 Mei 1862) merupakan seorang jenderal dan menteri berkebangsaan Prancis. Karya Ange-Hyacinthe de Damas, Mémoires du baron de Damas (1785–1862), publiées par son petit-fils Comte de Damas, Paris, 1922 (réédition: Phénix Editions, 2005 ISBN 2-7458-1444-3) Petr Zaborov, « Ja Rossii i russkih ne zabyvaju Dvadcat' pjat' pisem barona de Dama k semejstvu Oleninyh...

NFL lists Quarterbacks Career passing touchdowns leaders Career passing yards leaders Career passer rating leaders Career completions/attempts Career wins Playoff records Annual passing touchdowns leaders Annual passing yards leaders Annual passer rating leaders Annual completion percentage leaders 5,000-yard seasons Consecutive starts Consecutive games with TD pass Starting quarterbacks by team: BUFMIANENYJ BALCINCLEPIT HOUINDJAXTEN DENKCLVLAC DALNYGPHIWAS CHIDETGBMIN ATLCARNOTB ARILARSFSEA ...

 

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

 

Family of transport proteins Transferrin receptor 1Transferrin receptor 1, dimer, HumanIdentifiersSymbolTFRCAlt. symbolsCD71, TFR1NCBI gene7037HGNC11763OMIM190010RefSeqNM_003234UniProtP02786Other dataLocusChr. 3 q29Search forStructuresSwiss-modelDomainsInterPro Transferrin receptor 2IdentifiersSymbolTFR2Alt. symbolsHFE3, TFRC2NCBI gene7036HGNC11762OMIM604720RefSeqNM_003227UniProtQ9UP52Other dataLocusChr. 7 q22Search forStructuresSwiss-modelDomainsInterPro Transferrin receptor (TfR) is a carri...

American film company Paul Terrytoons ad in The Film Daily, 1932 by Educational Film Exchanges, Inc. Educational Pictures, also known as Educational Film Exchanges, Inc. or Educational Films Corporation of America, was an American film production and film distribution company founded in 1916 by Earle (E. W.) Hammons (1882–1962). Educational primarily distributed short subjects; it is best known for its series of comedies starring Buster Keaton[1] (1934– 37) and the earliest sc...

 

 

1963 film by Fletcher Markle Not to be confused with The Incredible Human Journey. The Incredible JourneyRe-release theatrical posterDirected byFletcher MarkleWritten byJames AlgarBased onThe Incredible Journeyby Sheila BurnfordProduced byJames AlgarWalt DisneyStarringÉmile GenestJohn DrainieTommy TweedSandra ScottNarrated byRex AllenCinematographyKenneth PeachEdited byNorman R. PalmerMusic byOliver WallaceProductioncompanyWalt Disney ProductionsDistributed byBuena Vista DistributionRelease ...

 

 

American philosopher (born 1957) Paul Moser Paul K. Moser (born 1957 in Bismarck, North Dakota) is an American philosopher who writes on epistemology and the philosophy of religion.[1] Moser is Professor of Philosophy at Loyola University Chicago[2] and a former editor of the American Philosophical Quarterly.[3] Critics have described Moser as a sceptic of natural theology[4] and a reformed epistemologist.[5] Moser has described himself as an evidential...

Israeli windsurfer (born 1975) Gal FridmanIsraeli Olympic gold medalist Gal Fridman in 2004Personal informationBorn (1975-09-16) September 16, 1975 (age 48)Karkur, IsraelHeight1.83 m (6 ft 0 in)[1]Weight68 kg (150 lb)[1]Other interestsCycling [1]SportCountry IsraelSportSailingEventMistralClubSdot YamCoached byMike GebhardtRetired2008Achievements and titlesOlympic finals (2004)World finals (2002)Regional finals (1995, 2002)Highest world ranking1st ...

 

 

United States historic placeMethodist CemeteryU.S. National Register of Historic Places LocationMurdock Mill Rd. between River Rd. and 42nd St., Washington, D.C.Coordinates38°56′55″N 77°04′53″W / 38.948738°N 77.08148°W / 38.948738; -77.08148Arealess than one acreBuilt1855MPSTenleytown in Washington, D.C.: 1770-1941, MPSNRHP reference No.08000839[1]Added to NRHPSeptember 5, 2008 The Methodist Cemetery is an historic cemetery, located at Mur...

 

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!