Read other articles:

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Kera shio – berita · surat kabar · buku · cendekiawan · JSTOR Shio Kera (Hanzi: 猴, Pinyin: Hóu) adalah shio kesembilan dari kedua belas shio yang ada dalam penanggalan Tionghoa. Orang yang bershi...

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

ГурдонGourdon Країна  Франція Регіон Овернь-Рона-Альпи  Департамент Ардеш  Округ Прива Кантон Прива Код INSEE 07098 Поштові індекси 07000 Координати 44°43′56″ пн. ш. 4°26′56″ сх. д.H G O Висота 514 - 1068 м.н.р.м. Площа 12,84 км² Населення 80 (01-2020[1]) Густота 7,55 ос./км² Розміщенн...

Cet article est une ébauche concernant le Kosovo et la Serbie. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Assemblée autonome de Kosovo-et-Métochie Présentation Type Assemblée de la Province autonome du Kosovo-et-Métochie Présidence Président Radovan Ničić Structure Membres 45 membres Données clésDonnées clés modifier Serbes au Kosovo et Albanais en Serbie centrale L'assemblée de la Communauté...

الحركة الشعبية هي وصفُ لحركة أو تغيير يبدأ بين أفراد لهم مصالح مشتركة والذين يمكن أن يحددوا وأن يتصرفوا بشكل جماعي. كاسم فأنه يشير إلى أفراد عاديين في المجتمع أو التنظيم. أما كصفة فأنه يشير إلى أصل أو أساس مبدأ أو فكرة، أو حركة. تستخدم الحركة الشعبية الناس في منطقة أو إقليم أ...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يوليو 2021) وحدة تحقيق الاستقرار هي وحدة حكومية تابعة لحكومة المملكة المتحدة، يحكمها مجلس الأمن القومي،[1] وتهدف إلى دعم الدول الهشة والدول الخارجة من الصراع،[2]...

TVRI Sulawesi SelatanLPP TVRI Stasiun Sulawesi SelatanGedung TVRI Stasiun Sulawesi Selatan di MakassarMakassar, Sulawesi SelatanIndonesiaSaluranDigital: 28 UHFVirtual: 2SloganMedia SipakaingaPemrogramanBahasaBahasa IndonesiaBahasa BugisBahasa MakassarBahasa TorajaAfiliasiTVRI, SEA Today, & ANTARA TVKepemilikanPemilikLPP TVRIRiwayatDidirikan7 Desember 1972Siaran perdana7 Desember 1972Bekas tanda panggilTVRI Ujung PandangTVRI MakassarBekas nomor kanal5 VHF (analog)37 UHF (analog)Informasi t...

1963 civil rights movement demonstration March on WashingtonPart of the Civil Rights MovementView from the Lincoln Memorial toward the Washington MonumentDateAugust 28, 1963; 60 years ago (1963-08-28)LocationWashington, D.C., U.S.38°53′21″N 77°3′0″W / 38.88917°N 77.05000°W / 38.88917; -77.05000Caused by Centennial signing of the Emancipation Proclamation Success of Birmingham campaign Mass movements and demonstrations throughout the United...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

Species of crustacean (Gecarcoidea natalis) Christmas Island red crab Megalopae of the crab Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Malacostraca Order: Decapoda Suborder: Pleocyemata Infraorder: Brachyura Family: Gecarcinidae Genus: Gecarcoidea Species: G. natalis Binomial name Gecarcoidea natalisPocock, 1888 Distribution map of Christmas Island red crab Female red crab about to release eggs into the sea The Christmas Island red crab (Gecar...

Emirati cyclist Badr MirzaPersonal informationFull nameBadr Mohamed Mirza Bani Al-HammadiBorn (1984-01-07) 7 January 1984 (age 39)Team informationCurrent teamRetiredDisciplineRoadRoleRiderProfessional teams2007–2009Doha Team2016Al Nasr Pro Cycling Team–Dubai Badr Mohamed Mirza Bani Al-Hammadi (born 7 January 1984) is an Emirati former racing cyclist.[1][2] His brother Yousif is also a professional cyclist, who rides for UAE Team Emirates. Major results 2006 ...

Intergovernmental organisation for research and development funding For other uses, see Eureka (disambiguation). This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Eureka organisation – news · newspapers · books · scholar · JSTOR (April 2007) (Learn how and when to remove this template message) EurekaFoundedJuly 17, 1985; 38 years ago...

Public schoolJohn Stanford International SchoolLocation4057 5th Ave. NE Seattle, Washington 98105 U.S.InformationTypePublicEstablished1891 (school) 1906 (this building)PrincipalSarah JonesEnrollment450 (approximately)CampusSuburbanColor(s)       MascotStarsWebsitestanfordes.seattleschools.org John Stanford International School is an elementary school located in the Wallingford neighborhood of Seattle, Washington, United States. It serves grades K-5 in the Seattle School Di...

American brand of chocolate For other uses, see Dove (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Dove chocolate brand – news · newspapers · books · scholar · JSTOR (December 2012) (Learn how and when to remove this template message) DoveProduct typeChocolateOwnerMars, IncorporatedP...

Species of lizard Kotschy's gecko Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Reptilia Order: Squamata Family: Gekkonidae Genus: Mediodactylus Species: M. kotschyi Binomial name Mediodactylus kotschyi(Steindachner, 1870) Synonyms[2] Gymnodactylus kotschyi Steindachner, 1870 Cytrodactylus [sic] kotschyi — Nader & Jawdat, 1976 Cyrtodactylus kotschyi — Baran & Grube...

1995 filmCharlie's Ghost StoryDirected byAnthony EdwardsWritten byLance W. Dreesen Clint HutchisonProduced byBarry L. Collier Steven PaulStarringCheech MarinCinematographySamuel AmeenMusic byJim KremensRelease date 1995 (1995) LanguageEnglish Charlie's Ghost Story, also known as Charlie's Ghost: The Secret of Coronado, is a 1995 American adventure-comedy film directed by Anthony Edwards, at his directorial debut. Based on a story by Mark Twain, it stars Cheech Marin, Trenton Knight, Anth...

Scottish Division One 1922-1923 Competizione Scottish Division One Sport Calcio Edizione 33ª Organizzatore SFL Date dal 15 agosto 1922al 28 aprile 1923 Luogo  Scozia Partecipanti 20 Formula Girone all'italiana A/R Risultati Vincitore Rangers(12º titolo) Retrocessioni Albion RoversAlloa Athletic Statistiche Miglior marcatore Jock White (30) Incontri disputati 380 Gol segnati 937 (2,47 per incontro) Cronologia della competizione 1921-22 1923-24 Manuale La Scottish Divis...

Iglesia de Sant Llorenç de les Arenes Tipo iglesiaEstilo arte románicoCatalogación Bien cultural parte del patrimonio cultural de CataluñaLocalización Foixá (España)Coordenadas 42°03′40″N 2°58′40″E / 42.06108333, 2.97774167Construcción siglo XIIjulianoCulto catolicismoDiócesis Diócesis de Gerona [editar datos en Wikidata] La iglesia de Sant Llorenç de les Arenes es la primitiva de Sant Romà de Sedillà, citada en el año 1065, que se trasladó a...

Chain of mountains in ProvenceFor the wine region, see Luberon AOC. Map of the Luberon and its surroundings View of vineyards in the Luberon massif from the village of Ménerbes, Vaucluse The Luberon (French pronunciation: [lyb(ə)ʁɔ̃] or [lybeʁɔ̃]; Provençal: Leberon (classical norm) or Leberoun (Mistralian norm)) is a massif in central Provence in Southern France, part of the French Prealps. It has a maximum elevation of 1,256 metres (4,121 ft) and an area of abo...

Spanish long-distance runner The topic of this article may not meet Wikipedia's notability guideline for sports and athletics. Please help to demonstrate the notability of the topic by citing reliable secondary sources that are independent of the topic and provide significant coverage of it beyond a mere trivial mention. If notability cannot be shown, the article is likely to be merged, redirected, or deleted.Find sources: Vanessa Veiga – news · newspapers · books...