Ernest Alley
|
Read other articles:
Nigeru wa Haji da ga Yaku ni Tatsu逃げるは恥だが役に立つGenreRomansa MangaPengarangTsunami UminoPenerbitKodanshaPenerbit bahasa InggrisKodansha ComicsMajalahKissDemografiJoseiTerbit9 November 2012 – 13 April 2020Volume11 Drama televisiSutradaraFuminori KanekoProduserYasuharu Ishii, Nobuhiro DoiSkenarioAkiko NogiMusikKenichiro SuehiroMAYUKOSaluranasliTBSTayang 11 Oktober 2016 – 20 Desember 2016Episode11 Portal anime dan manga Nigeru wa Haji da ga Yaku ni Tatsu (逃げる
AmiiboStandar internasionalKomunikasi jarak dekatDikembangkan olehNintendoDiperkenalkan10 Juni 2014 (2014-06-10)IndustriPermainan videoTipe konektorNirkabelPerangkat keras yang kompektibelWii U GamePadNew Nintendo 3DSNintendo 3DSKisaran fisik< 20 cm (7,9 in) Amiibo (Jepang: アミーボcode: ja is deprecated , Hepburn: Amībo, yang ditulis amiibo) adalah gudang protokol dan komunikasi nirkabel Nintendo, yang menggunakan item-item toys-to-life dan platform permainan Nintendo ...
هذه المقالة بحاجة لصندوق معلومات. فضلًا ساعد في تحسين هذه المقالة بإضافة صندوق معلومات مخصص إليها. علم النفس الإداري هو دورة دراسية أو أحد المجالات المتفرّعة من مجال علم النفس أو علم الإدارة، ويركّز على فهم العمق النفسي للسلوك المؤسسي ككل، ولكن من منظور إداري.[1] انظر أ...
Fort Purcell (more often known by the moniker The Dungeon) is a ruined fort near Pockwood Pond on the island of Tortola in the British Virgin Islands. History Inside of Fort Purcell, better known as The Dungeons The Fort was built by the Dutch at an unascertained date in either the late 16th or very early 17th century, and was known by the Spanish authorities in Puerto Rico as the donjon (from which the English name, the Dungeon comes – the fort has never actually been used as a dungeon)....
Rekonstruksi biota Ediakara yang dihasilkan dari Letusan Avalon Letusan Avalon (dari fauna prakambrium dari Semenanjung Avalon, Newfoundland, Kanada), adalah peristiwa radiasi evolusi yang terjadi sekitar 575 juta tahun lalu, pada periode Ediakarium,[1] yang ditandai dengan peningkatan kenaekaragaman organisme. Peristiwa ini terjadi sekitar 33 juta tahun lebih awal dari peristiwa letusan Kambrium. Paleontolog masih belum yakin secara menyeluruh mengenai perkembangan dari letusan Avalo...
Cathole MountainCathole Mountain from South MountainHighest pointElevation515 ft (157 m)Parent peak41° 33' 35N, 72° 48' 38WCoordinates41°34′33″N 72°48′02″W / 41.57583°N 72.80056°W / 41.57583; -72.80056 summit; 41°33′35″N 72°48′38″W / 41.55972°N 72.81056°W / 41.55972; -72.81056 southern ledge[1]GeographyCathole MountainLocation in Connecticut LocationMeriden, ConnecticutParent rangeHanging Hills / ...
Social learning process DeGroot learning refers to a rule-of-thumb type of social learning process. The idea was stated in its general form by the American statistician Morris H. DeGroot;[1] antecedents were articulated by John R. P. French[2] and Frank Harary.[3] The model has been used in physics, computer science and most widely in the theory of social networks.[4][5] Setup and the learning process Take a society of n {\displaystyle n} agents where e...
Health professions graduate school Touro University CaliforniaMottoTo Serve, To Lead, To Teach[1]Typeprivate graduate schoolParent institutionTouro College and University SystemReligious affiliationJudaismPresidentAlan Kadish[2]Academic staff105 full-time,[3] 87 part-timeStudents1,248 [4]LocationVallejo, California, United States38°05′13″N 122°15′51″W / 38.087°N 122.2643°W / 38.087; -122.2643CampusMidsize City,[5] 44 ...
American actress This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Patricia ChildressBornDallas, TexasOccupationsActressproducerdirec...
American mixed martial arts fighter For other people named Robert McCullough, see Robert McCullough (disambiguation). For the 1960s civil rights activist, see Friendship Nine. Not to be confused with Robert McCulloch (disambiguation). Rob McCulloughRob McCullough attending website Launch Party at The Kress Hollywood, CA on May 2, 2009Born (1977-05-26) May 26, 1977 (age 46)Huntington Beach, California, United StatesOther namesRazorNationalityAmericanHeight5 ft 8 in (1.73 m)...
Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dy...
2019 novel by Erin Morgenstern This article contains too many or overly lengthy quotations. Please help summarize the quotations. Consider transferring direct quotations to Wikiquote or excerpts to Wikisource. (April 2021) The Starless Sea First edition (UK)AuthorErin MorgensternCountryUnited StatesLanguageEnglishGenreFantasyPublisherDoubleday (US)Harvill Secker (UK)Publication dateNovember 5, 2019ISBN978-0-385-54121-3 The Starless Sea is a 2019 speculative fiction novel by Erin Morgenstern. ...
Municipality in French Community, BelgiumLes Bons Villers Les Bons Viyés (Walloon)MunicipalityTown hall FlagCoat of armsLocation of Les Bons Villers Les Bons VillersLocation in Belgium Location of Les Bons Villers in Hainaut Coordinates: 50°32′N 04°27′E / 50.533°N 4.450°E / 50.533; 4.450Country BelgiumCommunityFrench CommunityRegionWalloniaProvinceHainautArrondissementCharleroiGovernment • MayorMathieu Périn (cdH)(Citoyens) • ...
1998 SANFL Grand Final Sturt Port Adelaide 9.12 (66) 11.9 (75) 1 2 3 4 STU 2.4 (16) 4.8 (32) 5.12 (42) 9.12 (66) PTA 2.2 (14) 4.4 (28) 7.7 (49) 11.9 (75) DateSunday, 4 October (2:40 pm)StadiumFootball ParkAttendance44,838UmpiresPfeiffer, Avon, Woodcock ← 1997 1999 → The 1998 SANFL Grand Final was an Australian rules football competition. Port Adelaide beat Sturt by 75 to 66.[1] References ^ Australian Football - SANFL Season 1998. Archived from the original on 2 ...
Historic covered bridge in Washington state Grays River Covered BridgeCoordinates46°21′17.60″N 123°34′52.12″W / 46.3548889°N 123.5811444°W / 46.3548889; -123.5811444CarriesCovered Bridge RoadCrossesGrays RiverLocaleGrays River, WashingtonHeritage statusNRHPCharacteristicsDesignHowe trussMaterialTimberTotal length155.5 feet (47.4 m)Width14 feet (4.3 m)Height22.5 feet (6.9 m)Clearance above16.75 feet (5.11 m)HistoryConstruction end1905Gray...
Film festival 2014 Toronto International Film FestivalFestival posterOpening filmThe JudgeClosing filmA Little ChaosLocationToronto, Ontario, CanadaFounded1976AwardsThe Imitation Game (People's Choice Award)Hosted byToronto International Film Festival GroupNo. of films393 filmsFestival date4–14 September 2014Websitetiff.net The 39th annual Toronto International Film Festival, the 39th event in the Toronto International Film Festival series, was held in Canada from 4–14 September 2014.[...
Species of fungus Pleurotus djamor Scientific classification Domain: Eukaryota Kingdom: Fungi Division: Basidiomycota Class: Agaricomycetes Order: Agaricales Family: Pleurotaceae Genus: Pleurotus Species: P. djamor Binomial name Pleurotus djamor(Rumph. ex Fr.) Boedijn (1959) Species of fungus Pleurotus djamorMycological characteristicsGills on hymeniumCap is offsetHymenium is decurrentStipe is bareSpore print is pinkEcology is saprotrophicEdibility is choice Pleurotus djamor, commonly kn...
Japanese baseball player and manager This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Shinji Hamazaki – news · newspapers · books · scholar · JSTOR (April 2015) (Learn how and when to remove this template message) Baseball player Shinji HamazakiHamazaki in 1959Pitcher, ManagerBorn: (1901-12-10)December 10, 19...
Administración militar italiana en la Isla de CórcegaAmministrazione militare italiana nell'isola di Corsica Ocupación militar 1942-1943 Bandera Mapa que muestra Córcega (en la parte inferior derecha) ocupada por los italianos durante la Segunda Guerra Mundial.Entidad Ocupación militarHistoria • 8 de noviembrede 1942 Operación Anton • 1943 Operación Vesubio Precedido por Sucedido por ← → [editar datos en Wikidata] La ocupación italiana de Córce...
عزلة غرب مستباء - عزلة - تقسيم إداري البلد اليمن[1] المحافظة محافظة حجة المديرية مديرية مستباء خصائص جغرافية إحداثيات 16°14′29″N 43°14′16″E / 16.24141°N 43.23779°E / 16.24141; 43.23779 الارتفاع 216 متر السكان التعداد السكاني 2004 السكان 20٬309 • الذكور 10٬676 ...