Read other articles:
1988 single by Crowded House For the album by George Canyon, see Better Be Home Soon (album). Better Be Home SoonSingle by Crowded Housefrom the album Temple of Low Men B-sideKill EyeReleased12 June 1988 (1988-06-12)[1]Length3:07LabelCapitolSongwriter(s)Neil FinnProducer(s)Mitchell FroomCrowded House singles chronology Something So Strong (1987) Better Be Home Soon (1988) When You Come (1988) Audio samplefilehelp Better Be Home Soon (Sampleⓘ) is a song written by Neil...
Российско-танзанийские отношения Россия Танзания Медиафайлы на Викискладе Российско-танзанийские отношения — дипломатические отношения между Россией и африканским государством Танзания. Содержание 1 История 1.1 Послы СССР и РФ в Танзании 1.1.1 Послы СССР 1.1.2 Послы ...
Clasificación de UEFA para la Copa Mundial de Fútbol de 2002Europa 2000-2001 Fecha 16 de agosto de 200014 de noviembre de 2001 Cantidad de equipos 50 Equipos clasificados Ver listaFRA FranciaRUS RusiaPOR PortugalDEN DinamarcaSWE SueciaPOL PoloniaCRO CroaciaESP EspañaITA ItaliaENG InglaterraGER AlemaniaBEL Bélgica SLO Eslovenia TUR Turquía IRL Irlanda Partidos 240 Goles anotados 594 (2,48 por partido) Goleador...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2023) صاري عبد الله أفندي (ت. ١٠٧١ هـ) هو كاتب وشاعر صوفي عثمانى. هو عبد الله بن محمد بن عبد الله العثماني، المولوي، ويعرف بـ صاري عبد الله، وبـ شارح المثنوي.هو من أصل...
Chinese television series Scarlet HeartPromotional posterGenreRomance Historical fictionChuanyueBased onBu Bu Jing Xin by Tong HuaDirected byLee Kwok-lapStarringCecilia LiuNicky WuKevin ChengYuan HongLin GengxinOpening themeOne Persistent Thought by Hu Ge and AlanEnding themeThree Inches of Heaven by Ivy YanSeason of Waiting by Cecilia LiuComposerRaymond WongCountry of originChinaOriginal languageMandarinNo. of episodes35ProductionProducerKaren TsoiProduction locationChinaRunning time45 minsP...
لمعانٍ أخرى، طالع كلية العلوم (توضيح). كلية العلوم (جامعة أسوان) معلومات التأسيس 1975 تتبع جامعة جامعة أسوان الموقع الجغرافي إحداثيات 23°59′51″N 32°51′37″E / 23.997621896566°N 32.860272570656°E / 23.997621896566; 32.860272570656 المدينة أسوان البلد مصر إحصاءات متفرقات الموقع http://sci.aswu....
Indian TV series or program Rasoi ShowCreated byArchana ShahWritten byMittal shah Deepika KhumanDirected byKiran SutharPresented byMittal Shah Country of originIndiaOriginal languageGujaratiNo. of episodes6000 (as of 12 January 2023)ProductionProducerSuhas JahagirdarProduction locationsAhmedabad, Gujarat, IndiaCinematographyMukesh SharmaEditorsR. Patel Jayesh PancholiCamera setupMulti-cameraOriginal releaseNetworkColors GujaratiRelease25 October 2004 (2004-10-25) –present Ras...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Characters native to the African continent have been depicted in comics since the beginnings of the modern comic strip. Initially, such early 20th-century newspaper comics as Winsor McCay's Little Nemo depicted the racist stereotype of a spear-carrying cannibal, a comedic convention of the time. African characters later began to appear as another stereotype, the noble savage—a similar progression to that of depictions of Native Americans—and eventually as standard human beings. History Am...
Tyne and Wear Metro and bus interchange in South Tyneside South ShieldsTyne and Wear Metro stationGeneral informationLocationSouth Shields, South TynesideEnglandCoordinates54°59′50″N 1°25′59″W / 54.9971852°N 1.4330314°W / 54.9971852; -1.4330314Grid referenceNZ325651Transit authorityTyne and Wear PTEPlatforms1Tracks1Bus stands15ConstructionBicycle facilities4 cycle lockersAccessibleStep-free access to platformOther informationFare zoneCHistoryOriginal compan...
Artikel ini bukan mengenai Trans Semanggi Suroboyo. Layanan ini terkoneksi dengan moda angkutan perkotaan non bus seperti angkutan kota (bemo) dan Wirawiri Suroboyo di beberapa titik lokasi pada kawasan perkotaan Surabaya. Suroboyo BusSebuah unit koridor R5/R6 Suroboyo Bus melintasi Halte Gunung Anyar pada 17 Juni 2021.Didirikan7 April 2018Kantor pusatGedung PNR Mayjen Sungkono,Jalan Mayjen Sungkono Nomor 122, Kelurahan Gunungsari, Kecamatan Dukuh Pakis, Kota Surabaya, Provinsi Jawa Timur, Ko...
Parafia św. Jana Ewangelisty i NMP Matki Kościoła Kościół parafialny pw. św. Jana Ewangelisty i NMP Matki Kościoła Państwo Polska Siedziba Łódź Adres ul. Kazimierza Odnowiciela 592-414 Łódź Data powołania 1 października 1989 Wyznanie katolickie Kościół rzymskokatolicki Archidiecezja łódzka Dekanat Łódź-Olechów Proboszcz ks. kan. Grzegorz Michalski Wezwanie św. Jana Ewangelisty Wspomnienie liturgiczne poniedziałek po Uroczystości Zesłania Ducha Św.;27 grud...
Kibbutz in southern Israel Place in Southern, IsraelRevadim רבדיםرفاديمRevadimShow map of Ashkelon region of IsraelRevadimShow map of IsraelCoordinates: 31°46′25″N 34°49′1″E / 31.77361°N 34.81694°E / 31.77361; 34.81694CountryIsraelDistrictSouthernCouncilYoavAffiliationKibbutz MovementFounded14 February 1947 (original)28 November 1948 (current)Founded byHashomer Hatzair members (original)Bulgarian Jews (current)Population (2021)825[1]...
American physicist and mathematician (born 1955) Alan SokalSokal in 2011Born (1955-01-24) January 24, 1955 (age 68)Boston, Massachusetts, U.S.EducationHarvard University (B.A.) Princeton University (Ph.D.)Known forSokal AffairScientific careerFieldsPhysics, mathematics, philosophy of scienceInstitutionsNew York UniversityNational Autonomous University of NicaraguaUniversity College LondonThesisAn Alternate Constructive Approach to the φ43 Quantum Field Theory, and a Possible Destru...
Road in Malaysia Kajang BypassJalan Pintasan KajangRoute informationLength7.5 km (4.7 mi)Existed1997[1]–presentHistoryCompleted in 2004[2]Major junctionsNorthwest endSaujana ImpianMajor intersections Cheras–Kajang Expressway Cheras–Kajang Expressway Kajang Dispersal Link Expressway Kajang Dispersal Link Expressway Kajang–Seremban Highway Kajang–Seremban HighwaySoutheast endKajang Perdana Interchange LocationCountryMalaysiaPrimarydestinationsK...
Japanese curler Mao IshigakiCurlerBorn (1991-11-26) November 26, 1991 (age 32)Kitami, Hokkaido, Japan[1]TeamCurling clubTeam Fujikyu [ja], Fujiyoshida, Yamanashi, JapanSkipTori KoanaThirdYuna KotaniSecondMao IshigakiLeadArisa KotaniCurling career Member Association JapanWorld Championshipappearances1 (2018) Medal record Curling Representing Japan World Junior Curling Championships 2013 Sochi Pacific-Asia Junior Curling Championships 2011 Naseby 2012 Jeonju...
Terawan Agus PutrantoMenteri Kesehatan Indonesia ke-19Masa jabatan23 Oktober 2019 – 23 Desember 2020PresidenJoko WidodoPendahuluNila MoeloekPenggantiBudi Gunadi SadikinKepala Rumah Sakit Pusat Angkatan Darat Gatot SoebrotoMasa jabatan1 Juni 2015 – 23 Oktober 2019PendahuluHardjantoPenggantiBambang Dwi Hasto Informasi pribadiLahir5 Agustus 1964 (umur 59)Sitisewu, Yogyakarta, Daerah Istimewa Yogyakarta, Indonesia[1]KebangsaanIndonesiaPartai politikIndepende...
This article needs to be updated. Please help update this article to reflect recent events or newly available information. (September 2017) Trends in the five nations with the largest annual net imports of natural gas This is a list of countries by natural gas imports mostly based on The World Factbook [1] and EIA [2]. For informational purposes several non-sovereign entities are also included in this list. Many countries are both importers and exporters of natural gas. For instance, although...
American law school For the Colorado college, see Western State Colorado University. Western State College of Law at Westcliff UniversityParent schoolWestcliff UniversityEstablished1966School typePrivate for-profit law school[1]DeanAllen Easley[2]LocationIrvine, California, United States33°23′35″N 117°27′14″W / 33.39304°N 117.45394°W / 33.39304; -117.45394Enrollment198 (full-time) 110 (part-time)Faculty27USNWR ranking148th-194th (bottom 25%)...
2022 concert tour by Dreamcatcher 2022 Dreamcatcher World Tour [Apocalypse: Save Us]World tour by DreamcatcherPromotional poster for the tour's North America legAssociated albumApocalypse: Save UsStart dateJune 28, 2022 (2022-06-28)End dateJuly 20, 2022 (2022-07-20)Legs2No. of shows9 in North America1 in Latin America10 in totalDreamcatcher concert chronology Dreamcatcher Concert: Invitation from Nightmare City(2019) Dreamcatcher World Tour [Apocalypse: Save Us](...
Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!