Keuskupan Agung Praha
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Read other articles:
Buaya irian Kepala buaya irian Status konservasi Risiko Rendah (IUCN 3.1) Klasifikasi ilmiah Kerajaan: Animalia Filum: Chordata Kelas: Sauropsida Ordo: Crocodilia Famili: Crocodylidae Genus: Crocodylus Spesies: C. novaeguineae Nama binomial Crocodylus novaeguineae Buaya irian (Crocodylus novaeguineae) adalah salah satu spesies buaya yang ditemukan menyebar di perairan tawar pedalaman Pulau Papua. Bentuk umum jenis ini mirip dengan buaya muara (C. porosus), tetapi lebih kecil dan war...
1932 popular music song For the 1975 documentary film, see Brother, Can You Spare a Dime? (film). Brother, Can You Spare a Dime?Sheet music cover for AmericanaSongComposer(s)Jay GorneyLyricist(s)Yip Harburg Brother, Can You Spare a Dime? is one of the best-known American songs of the Great Depression. Written by lyricist Yip Harburg and composer Jay Gorney, it was part of the 1932 musical revue Americana; the melody is based on a Russian-Jewish lullaby. The song tells the story of the univers...
Keuskupan TongaDioecesis TonganaKatolik Lambang keuskupanLokasiNegaraTongaWilayahTonga dan NiueProvinsi gerejawiTunduk langsung kepada Tahta SuciStatistikLuas947 km2 (366 sq mi)Populasi- Total- Katolik(per 2011)104.66017,000 (7.6%)Paroki14Imam38InformasiDenominasiGereja KatolikGereja sui iurisGereja LatinRitusRitus RomaPendirian12 Juni 1966KatedralKatedral Santa Maria, Tonga (Tonga: Malia Tupu Imakulata)PelindungDikandung Tanpa NodaKepemimpinan kiniPausFrans...
Not to be confused with Mitsubishi Saturn engine. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Saturn I4 engine – news · newspapers · books · scholar · JSTOR (August 2013) (Learn how and when to remove this template message) Reciprocating internal combustion engine Saturn engineOverviewManufacturerSaturn ...
يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (ديسمبر 2018) مجدليا الإحداثيات 33°45′18″N 35°34′23″E / 33.755°N 35.573055555556°E / 33.755; 35.573055555556 تقسيم إداري البلد...
Adaljiza Albertina Xavier Reis Magno (lahir 7 Januari 1975), adalah seorang politikus asal Timor Leste. Ia menjadi Menteri Urusan Luar Negeri dari 19 Mei sampai 8 Agustus 2007.[1] Referensi ^ Archived copy. Diarsipkan dari versi asli tanggal 2012-10-12. Diakses tanggal 2011-06-29. Parameter |url-status= yang tidak diketahui akan diabaikan (bantuan) Artikel bertopik politikus ini adalah sebuah rintisan. Anda dapat membantu Wikipedia dengan mengembangkannya.lbs Artikel bertop...
Award category recognising excellence by an actress in a supporting performance This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Golden Globe Award for Best Supporting Actress – Motion Picture – news · newspapers · books · scholar · JSTOR (March 2021) Golden Globe Award for Best Supporting Actress
The list of shipwrecks in April 1872 includes ships sunk, foundered, grounded, or otherwise lost during April 1872. This is a dynamic list and may never be able to satisfy particular standards for completeness. You can help by adding missing items with reliable sources. April 1872 MonTueWedThuFriSatSun 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 Unknown date References 1 April List of shipwrecks: 1 April 1872 Ship Country Description Amanda Jane Canada The...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
1916 film by Frederick A. Thomson Nearly a KingNewspaper advertisementDirected byFrederick A. ThomsonWritten byWilliam Clifford (orig. screen story)Produced byAdolph ZukorStarringJohn BarrymoreDistributed byParamount PicturesRelease date February 10, 1916 (1916-02-10) Running time5 reelsCountryUnited StatesLanguageSilent film(English intertitles) Nearly a King is a 1916 silent film romantic comedy directed by Frederick A. Thomson, produced by Famous Players Film Company and dis...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Kynžvart Castle – news · newspapers · books · scholar · JSTOR (March 2013) (Learn how and when to remove this template message) Kynžvart Castle in 2009 Kynžvart Castle (Czech: Zámek Kynžvart; German: Schloss Königswart) is a historic château located near...
District in Tehran province, Iran For the city, see Javadabad, Varamin. For other places with a similar name, see Javadabad (disambiguation). District in Tehran, IranJavadabad District Persian: بخش جوادآبادDistrictJavadabad DistrictCoordinates: 35°06′37″N 51°44′42″E / 35.11028°N 51.74500°E / 35.11028; 51.74500[1]Country IranProvinceTehranCountyVaraminCapitalJavadabadPopulation (2016)[2] • Total24,975Time zone...
Taxila local single-die coinage. (220-185 BCE). This early coins displays an arched-hill symbol, a tree-in-railing, a Nandipada and a Swastika. The reverse is blank.[1] The Post-Mauryan coinage of Gandhara refers to the period of coinage production in Gandhara, following the breakup of the Maurya Empire (321-185 BCE). When Mauryan central power disappeared, several small independent entities were formed, which started to strike their own coins, defining a period of Post-Mauryan coinag...
Austrian conductor and opera administrator Peter Schneider (born 26 March 1939, in Vienna) is an Austrian conductor and opera administrator. Schneider served as kapellmeister of the Deutsche Oper am Rhein, Düsseldorf-Duisburg from 1961 to 1968; general music director of the Bremer Philharmoniker from 1978 to 1985; opera director and general music director of Nationaltheater Mannheim from 1985 to 1987; and general music director of the Bayerische Staatsoper orchestra, München from 1993 to 19...
Crater on the Moon Feature on the moonBuffonOblique Lunar Orbiter 5 image of most of Buffon(white triangle is blemish on original)Coordinates40°24′S 133°24′W / 40.4°S 133.4°W / -40.4; -133.4Diameter106 kmDepthUnknownColongitude135° at sunriseEponymComte de Buffon Another oblique Lunar Orbiter 5 view Buffon is a lunar impact crater that is located on the southern hemisphere on the far side of the Moon. It lies a crater diameter south of the large walled plain C...
Staf Khusus Presiden adalah lembaga non struktural yang dibentuk untuk memperlancar pelaksanaan tugas Presiden Republik Indonesia, di luar tugas-tugas yang sudah dicakup dalam susunan Kementerian dan instansi pemerintah lainnya. Berdasarkan Pasal 1 dan 2 Peraturan Presiden Nomor 17 tahun 2012 tentang Utusan Khusus Presiden, Staf Khusus Presiden dan Staf Khusus Wakil Presiden dan Peraturan Presiden Nomor 39 Tahun 2018 tentang Perubahan Kedua Atas Peraturan Presiden Nomor 17 tahun 2012 tentang ...
This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: People's Power Colombia – news · newspapers · books · scholar · JSTOR (December 2009) (Learn how and when to remove this template message) This article is part of a series on thePolitics ofColombia Government Constitution of Colombia Law Taxation Policy Executive President ...
تحتاج هذه المقالة كاملةً أو أجزاءً منها إلى تدقيق لغوي أو نحوي. فضلًا ساهم في تحسينها من خلال الصيانة اللغوية والنحوية المناسبة. (يناير 2020) جزء من سلسلة مقالات سياسة الولايات المتحدةالولايات المتحدة الدستور الدستور الضرائب السلطة التنفيذية الحكومة الفيدرالية الرئيس (قائم...
Protein-coding gene in the species Homo sapiens BCAR3Available structuresPDBOrtholog search: PDBe RCSB List of PDB id codes3T6AIdentifiersAliasesBCAR3, NSP2, SH2D3B, breast cancer anti-estrogen resistance 3, AND-34, NSP family adaptor protein, BCAR3 adaptor protein, NSP family member, MIG7External IDsOMIM: 604704 MGI: 1352501 HomoloGene: 31181 GeneCards: BCAR3 Gene location (Human)Chr.Chromosome 1 (human)[1]Band1p22.1Start93,561,741 bp[1]End93,847,150 bp[1]Gene locatio...
2012 film This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Dysfunctional Friends – news · newspapers · books · scholar · JSTOR (January 2014) (Learn how and...
Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!