Read other articles:
Station Intxaurrondo Plaats San Sebastian Opening 12 mei 2011 Perronsporen 2 Lijn(en) Spoorlijn Madrid-Hendaye Eigendom ADIF Vervoerder(s) Renfe Lijnen Trein Cercanías San Sebastian Bus Stadsbussen Locatie Coördinaten 43° 19′ NB, 1° 57′ WL Portaal Openbaar vervoer Spanje Station Intxaurrondo is een spoorweghalte in het district Intxaurrondo van de Spaanse stad San Sebastian, in de autonome gemeenschap Baskenland. De halte bevindt zich bij kilometerpunt 624,7...
Klausen Gemeente in Duitsland Situering Deelstaat Rijnland-Palts Landkreis Bernkastel-Wittlich Verbandsgemeinde Wittlich-Land Coördinaten 49° 54′ NB, 6° 53′ OL Algemeen Oppervlakte 9,22 km² Inwoners (31-12-2020[1]) 1.413 (153 inw./km²) Hoogte 245 m Burgemeester Alois Meyer Overig Postcode 54524 Netnummer 06578 Kenteken WIL (alternatief: BKS) Gemeentekernen 2 delen (Ortsteil) Gemeentenr. 07 2 31 069 Website www.klausen.de Locatie van Klausen in Bernkastel-Wittlich...
Pour les articles homonymes, voir Chardon (homonymie). Ordre du Chardon Insigne de l'ordre du Chardon Décernée par Écosse Type Ordre de chevalerie Décerné pour À la volonté du monarque aux chevaliers écossais Statut Toujours décerné Chiffres Date de création 1687 Importance Ordre de Saint-Patrick ()Ordre du Bain () Ordre de la Jarretière Ruban de l'ordre modifier Chevalier de l’ordre du Chardon.Le prince Augustus Frederick, duc du Sussex, en tenue de chevalier (1842). L’...
Sungai BohKecamatanPeta lokasi Kecamatan Sungai BohNegara IndonesiaProvinsiKalimantan UtaraKabupatenMalinauPemerintahan • CamatYordin Ingan. S.Th[1]Populasi (2022)[2] • Total2.384 jiwa • Kepadatan0,84/km2 (2,2/sq mi)Kode Kemendagri65.02.09 Kode BPS6501010 Luas2.801,51 km2Desa/kelurahan6/- Sungai Boh adalah sebuah kecamatan di Kabupaten Malinau, provinsi Kalimantan Utara, Indonesia. Kecamatan Sungai Boh berbatasan langsung deng...
Franco-German romantic author and historian (1805–1876) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Marie d'Agoult – news · newspapers · books · scholar · JSTOR (September 2022) (Learn how and when to remove this template message) Marie d'AgoultMarie d'Agoult (1843), painting by Henri Lehmann.BornMarie...
Его Высокопреосвященство кардиналШандор (Александр) Руднаивенг. Rudnay Sándor Флаг Архиепископ Эстергома и примас Венгрии 17 декабря 1819 года — 13 сентября 1831 года Церковь Римско-католическая церковь Предшественник Карл Габсбург Преемник Йожеф Копачи Рождение 4 октября 17...
2011 soundtrack album by Tennant/LoweThe Most Incredible ThingSoundtrack album by Tennant/LoweReleased14 March 2011 (2011-03-14)Recorded2009–2010VenueConcert Hall of Polish Radio(Wrocław, Poland)[a]Genre Electronic classical Length83:33LabelParlophoneProducer Pet Shop Boys Sven Helbig Pet Shop Boys chronology Ultimate(2010) The Most Incredible Thing(2011) Format(2012) Tennant/Lowe soundtrack album chronology Battleship Potemkin(2005) The Most Incredible Thing...
Kenai-Fjords-Nationalpark Kenai-Fjords-NationalparkKenai-Fjords-Nationalpark Kenai-Fjords-Nationalpark (Alaska) 59.983888888889-149.78277777778Koordinaten: 59° 59′ 2″ N, 149° 46′ 58″ W Lage: Alaska, Vereinigte Staaten Nächste Stadt: Seward (Alaska) Fläche: 2.709,98 km² Gründung: 2. Dezember 1980 Besucher: 321.596 (2018) Adresse: Kenai Fjords National Park i3i6 Der Kenai-Fjords-Nationalpark (englisch Kenai Fjords National Park) ist ein Nati...
This article may need to be rewritten to comply with Wikipedia's quality standards. You can help. The talk page may contain suggestions. (October 2020) Overview of the economy in Isfahan Economy of IsfahanCurrencyIranian rial ريالStatisticsMain industriesiron, steel, mining, export, infrastructure building All values, unless otherwise stated, are in US dollars. Isfahan city City Politics in Isfahan Isfahan Police Ecology in Isfahan Economy in Isfahan Culture in Isfahan Timeline of Isfahan...
American professional wrestler and mixed martial artist Bart GunnPolchlopek in June 1995Birth nameMichael Polchlopek[1]Born (1965-12-27) December 27, 1965 (age 57)[2]Titusville, Florida,United States[1]Professional wrestling careerRing name(s)Bart Gunn[3]Bodacious Bart[2]Brett Colt[2]Mike Barton[2]Billed height6 ft 4 in (193 cm)[4]Billed weight275 lb (125 kg)[4]Billed fromAustin, Texas[2&...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Piotr i PawełTypeJoint-stock companyIndustryRetailFounded1990; 33 years ago (1990)FoundersPiotr Woś, Paweł Woś, Eleonora WośDefunctEnd of 2019HeadquartersPoznań, PolandNumber of locationsLess than 70 (2019)Area servedPolandKey peopleMaciej StoińskiRevenuezl 2.123 billionNet incomezl 514 million (2016)[1]Number of employees4000 (2010)Websitewww.piotripawel.pl Piotr i Paweł was a retail chain of delicatessen and supermarket stores.[2]...
American artist, writer and educator Jenny Odell (born 1986)[1] is an American multidisciplinary artist, writer, and educator based in Oakland, California.[2][3] She taught Internet art and digital/physical design at Stanford University from 2013 to 2021.[4][5] She wrote The New York Times best-selling book How to Do Nothing: Resisting the Attention Economy (2019).[6][7] Early life and education Odell was born in San Francisco[8]...
Temperate forest in Brittany, France This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Paimpont forest – news · newspapers · books · scholar · JSTOR (October 2020) (Learn how and when to remove this template message) Paimpont forestForêt de Paimpont / BrocéliandeKoad PempontGeographyLocationAround Ille-et-Vi...
2012 Finnish presidential election ← 2006 22 January 2012 (first round)5 February 2012 (second round) 2018 → Candidate Sauli Niinistö Pekka Haavisto Party National Coalition VIHR Popular vote 1,802,328 1,077,425 Percentage 62.59% 37.41% Results by municipalityResults by electoral districtNiinistö: 50–55% 55–60% 60–65% 65–70% ...
National beach handball team of Vietnam VietnamInformationAssociationVietnam Handball FederationCoach Huỳnh Minh NgônColours Home Away ResultsWorld GamesAppearances1 (First in 2022)Best resultWithdrew (2022)World ChampionshipAppearances3 (First in 2018)Best result9th (2018) Last updated on May 2022. Vietnam women's national beach handball team Medal record Representing Vietnam Asian Championship 2023 Indonesia 2022 Thailand 2017 Thailand 2019 China 2015 Oman Asian Beach Games 201...
1979 studio album by Horace SilverSilver 'n Strings Play the Music of the SpheresStudio album by Horace SilverReleased1979RecordedNovember 3 & 10, 1978, October 26 & November 2, 1979StudioVan Gelder Studio, Englewood Cliffs, NJGenreJazzLabelBlue NoteProducerHorace SilverHorace Silver chronology Silver 'n Percussion(1977) Silver 'n Strings Play the Music of the Spheres(1979) Guides to Growing Up(1981) Professional ratingsReview scoresSourceRatingAllmusic[1]The Rolling S...
South Korean television presenter Jang Ye-wonJang in 2014Born (1990-07-14) July 14, 1990 (age 33)Seoul, South KoreaEducationSookmyung Women's UniversityOccupation(s)Broadcast personality, hostYears active2012–presentAgentSM C&CRelativesJang Ye-in (sister)Korean nameHangul장예원Hanja張叡元Revised RomanizationJang YewonMcCune–ReischauerChang Yewŏn Jang Ye-won (Korean: 장예원; born July 14, 1990) is a South Korean television personality and host. She was an a...
Irish actor (1877-1964) For the Irish Republican Brotherhood member, see Charles Guilfoyle Doran. Doran as Hamlet Charles Doran (1 January 1877 – 5 April 1964) was an Irish actor, one of the last of the touring actor-managers in the tradition of Frank Benson, John Martin-Harvey and Ben Greet. Among those who joined his company at the start of their careers were Cecil Parker, Ralph Richardson, Francis L Sullivan and Donald Wolfit. Doran toured with Benson and other managements, and played in...
InnimontInnimont Lokasi di Region Auvergne-Rhône-Alpes Innimont Koordinat: 45°46′58″N 5°34′20″E / 45.7828°N 5.5722°E / 45.7828; 5.5722NegaraPrancisRegionAuvergne-Rhône-AlpesDepartemenAinArondisemenBelleyKantonLhuisAntarkomuneRhône Chartreuse de PortesPemerintahan • Wali kota (2008–2014) Eric NodetLuas • Land113,44 km2 (519 sq mi) • Populasi2111 • Kepadatan Populasi20,083/km2 (0,21/sq m...